PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN29727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 575aa    MW: 63623.2 Da    PI: 6.1979
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN29727.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.62.1e-084925301854
                 HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  KHN29727.1 492 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 530
                 5776679******************************88 PP

2BELL70.43.3e-23364433171
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                 +r++ ++kka+Ll ll+  d+rY+q+ ++++tv+s+F+a+++l++ ++++++Al++iS  ++ L+++i++ 
  KHN29727.1 364 QRHAAESKKAQLLALLQLADNRYSQCLDEIHTVVSAFHAATELDP-QIHAHFALQTISILYKDLRERISNY 433
                 68999****************************************.**********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-21288432IPR006563POX domain
PfamPF075264.2E-24294431IPR006563POX domain
SMARTSM003898.0E-6474538IPR001356Homeobox domain
CDDcd000868.73E-11474535No hitNo description
SuperFamilySSF466894.71E-15476543IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-25477540IPR009057Homeodomain-like
PfamPF059209.2E-15491530IPR008422Homeobox KN domain
PROSITE profilePS5007110.851493534IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MLMESDMYTA ALGISGRDAR VIDEISQHST SNPLVQCYSL DLNNQSHIIN GISMLSGEQG  60
EPINNVHGDA CFINPSIIAD SSPLVTSQGK TIVGDASSPM ENTEFQEHLV GGMSITPSSL  120
VAILAARIGF EENLENSSSA LPPSLCSIGA LGAFFNNLQG TSNSNPLSAT FEDCGYNEVP  180
GNWNANKFPK APEIHGTGCQ PYSSLANLDP NEWTSSNLAN MANHANHSSS FSKELSLSLA  240
TSTTTGQCSE VSCSNVTPCM NGTMSGLEQA FCGSSRELSM NLGGDKYVQF SPKVLESRYL  300
IGIREILAQI ARYSFENLEQ LNYSASGNRS GGNKSSSAFP PKRRILIDNN ANSTYEAHAE  360
PPLQRHAAES KKAQLLALLQ LADNRYSQCL DEIHTVVSAF HAATELDPQI HAHFALQTIS  420
ILYKDLRERI SNYILAMGSN FNNSCSEENE WSAETSFLQK QWALQQLNRK DQLWRPQRGL  480
PERSVWVLRA WMFQNFLHPY PKDAEKHLLA VKSGLTRSQV SNWFINARVR LWKPMIEEMY  540
AEMNKRKACR NEEGMQSNHG NRISMSNQRF NQCQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A4e-14480538159Homeobox protein Meis2
5bng_B4e-14480538159Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0945590.0BT094559.1 Soybean clone JCVI-FLGm-18H4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006577867.10.0PREDICTED: uncharacterized protein LOC100820354 isoform X1
RefseqXP_006577866.10.0PREDICTED: uncharacterized protein LOC100820354 isoform X1
RefseqXP_006577868.10.0PREDICTED: uncharacterized protein LOC100820354 isoform X1
SwissprotP487311e-102ATH1_ARATH; Homeobox protein ATH1
TrEMBLA0A0B2RCX20.0A0A0B2RCX2_GLYSO; Homeobox protein ATH1
TrEMBLK7KI690.0K7KI69_SOYBN; Uncharacterized protein
STRINGGLYMA04G05361.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.15e-88homeobox gene 1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]